PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA26G00481
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 768aa    MW: 87209.1 Da    PI: 4.7033
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA26G00481genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.43.3e-08477521246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +WT+ Ed++l+ +++q   ++W  Ia  +g++Rt+ qc  r+q 
       AA26G00481 477 SPWTAAEDKKLLLVIHQKNFEDWLDIALSLGTNRTPFQCLARYQR 521
                      58*****************************************96 PP

2Myb_DNA-binding46.96.3e-15529575148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r  WT+eEd++l  av ++G ++W ++a+ +  gRt+ qc +rw k l
       AA26G00481 529 RREWTAEEDDQLRAAVDLYGEKDWQSVANALV-GRTGTQCSNRWKKTL 575
                      678*****************************.***********9975 PP

3Myb_DNA-binding47.73.7e-15583626246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      grW+ +Ed++ + av+++G ++W +Ia+ ++ gRt+ qc++rw +
       AA26G00481 583 GRWSSDEDKRMKVAVTLFGAKNWYKIAQFVP-GRTPPQCRERWVN 626
                      8******************************.***********87 PP

4Myb_DNA-binding45.41.9e-14634679147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+WT eEd  l +a+ ++G  +W+++a+ ++  Rt++qc  r+ k+
       AA26G00481 634 RGPWTNEEDTMLREAISEHGYSSWSKVASQIP-SRTDNQCWRRYKKL 679
                      89******************************.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.842374466IPR017877Myb-like domain
SMARTSM007170.95378472IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-8381397IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-8443477IPR009057Homeodomain-like
SuperFamilySSF466891.32E-14452523IPR009057Homeodomain-like
PROSITE profilePS500908.13471523IPR017877Myb-like domain
SMARTSM007172.6E-7475525IPR001005SANT/Myb domain
PfamPF002493.0E-7477521IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-8478524IPR009057Homeodomain-like
SuperFamilySSF466893.8E-19508581IPR009057Homeodomain-like
PROSITE profilePS5129422.661524579IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-17525580IPR009057Homeodomain-like
SMARTSM007174.6E-15528577IPR001005SANT/Myb domain
PfamPF002492.7E-13529574IPR001005SANT/Myb domain
CDDcd001675.18E-12531575No hitNo description
PROSITE profilePS5129411.736580628IPR017930Myb domain
SMARTSM007171.5E-11581630IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-21583633IPR009057Homeodomain-like
PfamPF002492.3E-12583626IPR001005SANT/Myb domain
CDDcd001674.22E-10584628No hitNo description
SuperFamilySSF466898.99E-27608683IPR009057Homeodomain-like
PROSITE profilePS5129422.685629684IPR017930Myb domain
SMARTSM007171.5E-11633682IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-19634679IPR009057Homeodomain-like
PfamPF002497.0E-14634679IPR001005SANT/Myb domain
CDDcd001674.10E-11636679No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MNRDGLYEAD DDDDVEDEED DGIGEDLEDI RRACMVTESN SDENTARNGD LGECVGGEEN  60
QTGSVGVNEG DGEGIPSDSD NEGDMEMLRS IKDRLALSTD VCDVSPMGLG IPLDSESEDD  120
MEMLRSIKSR LALSMDEFRP SMGLSEEDDD DNDAFETLRA IRRRFSAYEN FDPEGNFTDD  180
SPGKKKQVLA SDNETSSEIL SRSNTCESFP DQGKRIASVP DSEEAQAGHS VDRHENTAIV  240
PFGQLETCQS SLVPAASSSF PESAQAFVEA IRRNRAYQRF LRRKMTEIEA TIEQNEKHKK  300
NVKILKEFQA SCKKITKQAL SQKKDPRLEL ISTQKSGPSD DSTEGNDKKI SPLTFGPLEN  360
PRVANYRMAL EKNPLSVDRR NWSAEENENL AKGLKQQVQE ALLFEAMDQS SGIEGYTDDL  420
DSVLETIKNL EITPEMIRQF LPKVSWDQLA SMYVKDRSAA ECESRWMSCE DPLVNHSPWT  480
AAEDKKLLLV IHQKNFEDWL DIALSLGTNR TPFQCLARYQ RSLNAGFLRR EWTAEEDDQL  540
RAAVDLYGEK DWQSVANALV GRTGTQCSNR WKKTLHPTRK KVGRWSSDED KRMKVAVTLF  600
GAKNWYKIAQ FVPGRTPPQC RERWVNSLDP EVNRGPWTNE EDTMLREAIS EHGYSSWSKV  660
ASQIPSRTDN QCWRRYKKLY PHQLPLLQEA RKLRRESVVG NFVDRESERP ALGLNEFLAL  720
PAITLEPEPE VLALTCKTKS RLSKWCSCYK EATKEKEKTN REMFKKCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C8e-314466768159MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-314466768159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010506400.10.0PREDICTED: snRNA-activating protein complex subunit 4-like isoform X2
TrEMBLD7L7Z60.0D7L7Z6_ARALL; MYB4R1
STRINGfgenesh2_kg.3__2002__AT3G18100.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65042744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1